Lineage for d3hgwc_ (3hgw C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732498Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 2732499Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 2732500Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 2732520Protein automated matches [191058] (2 species)
    not a true protein
  7. 2732524Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)
  8. 2732531Domain d3hgwc_: 3hgw C: [177561]
    automated match to d2h9ca1
    complexed with ca; mutant

Details for d3hgwc_

PDB Entry: 3hgw (more details), 2.25 Å

PDB Description: apo structure of pseudomonas aeruginosa isochorismate-pyruvate lyase i87t mutant
PDB Compounds: (C:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3hgwc_:

Sequence, based on SEQRES records: (download)

>d3hgwc_ a.130.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlper
arwaeengldapfveglfaqiihwytaeqikywrqtr

Sequence, based on observed residues (ATOM records): (download)

>d3hgwc_ a.130.1.1 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ktpedctgladireaidridldivqalgrrmdyvkaasvaamlperarwaeengldapfv
eglfaqiihwytaeqikywrqtr

SCOPe Domain Coordinates for d3hgwc_:

Click to download the PDB-style file with coordinates for d3hgwc_.
(The format of our PDB-style files is described here.)

Timeline for d3hgwc_: