Class a: All alpha proteins [46456] (290 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins) intertwined homodimer of 3-helical subunits |
Protein automated matches [191058] (2 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries) |
Domain d3hgwb_: 3hgw B: [177560] automated match to d2h9ca1 complexed with ca; mutant |
PDB Entry: 3hgw (more details), 2.25 Å
SCOPe Domain Sequences for d3hgwb_:
Sequence, based on SEQRES records: (download)
>d3hgwb_ a.130.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlperarwaeeng ldapfveglfaqiihwytaeqiky
>d3hgwb_ a.130.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ladireaidridldivqalgrrmdyvkaasrfpervaamlperarwaeengldapfvegl faqiihwytaeqiky
Timeline for d3hgwb_: