Lineage for d3hgwa_ (3hgw A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 924951Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 924952Superfamily a.130.1: Chorismate mutase II [48600] (4 families) (S)
  5. 924953Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 924973Protein automated matches [191058] (1 species)
    not a true protein
  7. 924974Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)
  8. 924979Domain d3hgwa_: 3hgw A: [177559]
    automated match to d2h9ca1
    complexed with ca; mutant

Details for d3hgwa_

PDB Entry: 3hgw (more details), 2.25 Å

PDB Description: apo structure of pseudomonas aeruginosa isochorismate-pyruvate lyase i87t mutant
PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3hgwa_:

Sequence, based on SEQRES records: (download)

>d3hgwa_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlper
arwaeengldapfveglfaqiihwytaeqikyw

Sequence, based on observed residues (ATOM records): (download)

>d3hgwa_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ktpedctgladireaidridldivqalgrrmdyvkaasrfkaamlperarwaeengldap
fveglfaqiihwytaeqikyw

SCOPe Domain Coordinates for d3hgwa_:

Click to download the PDB-style file with coordinates for d3hgwa_.
(The format of our PDB-style files is described here.)

Timeline for d3hgwa_: