SCOPe 2.08: Domain d3hgwa_: 3hgw A:

Lineage for d3hgwa_ (3hgw A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein automated matches [191058] (2 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [188941] (4 PDB entries)

8. Domain d3hgwa_: 3hgw A: [177559]
   automated match to d2h9ca1
   complexed with ca; mutant

Details for d3hgwa_

PDB Entry: 3hgw, 2.25 Å

PDB Description: apo structure of pseudomonas aeruginosa isochorismate-pyruvate lyase i87t mutant

PDB Compounds: (A:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d3hgwa_:

Sequence, based on SEQRES records:

>d3hgwa_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlper
arwaeengldapfveglfaqiihwytaeqikyw

Sequence, based on observed residues (ATOM records):

>d3hgwa_ a.130.1.1 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
ktpedctgladireaidridldivqalgrrmdyvkaasrfkaamlperarwaeengldap
fveglfaqiihwytaeqikyw

Timeline for d3hgwa_:

• d3hgwa_ first appeared in SCOPe 2.01
  
• d3hgwa_ appears in SCOPe 2.07