Lineage for d3hgsb_ (3hgs B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080474Species Solanum lycopersicum [TaxId:4081] [187823] (5 PDB entries)
  8. 2080480Domain d3hgsb_: 3hgs B: [177558]
    automated match to d1q45a_
    complexed with fmn, phb

Details for d3hgsb_

PDB Entry: 3hgs (more details), 2 Å

PDB Description: crystal structure of tomato opr3 in complex with phb
PDB Compounds: (B:) 12-oxophytodienoate reductase 3

SCOPe Domain Sequences for d3hgsb_:

Sequence, based on SEQRES records: (download)

>d3hgsb_ c.1.4.1 (B:) automated matches {Solanum lycopersicum [TaxId: 4081]}
nplfspykmgkfnlshrvvlapmtrcralnnipqaalgeyyeqrataggflitegtmisp
tsagfphvpgiftkeqvrewkkivdvvhakgavifcqlwhvgrashevyqpagaapisst
ekpisnrwrilmpdgthgiypkpraigtyeisqvvedyrrsalnaieagfdgieihgahg
ylidqflkdgindrtdeyggslanrckfitqvvqavvsaigadrvgvrvspaidhldamd
snplslglavverlnkiqlhsgsklaylhvtqpryvaygqteagrlgseeeearlmrtlr
nayqgtficsggytrelgieavaqgdadlvsygrlfisnpdlvmriklnaplnkynrktf
ytqdpvvgytdypflq

Sequence, based on observed residues (ATOM records): (download)

>d3hgsb_ c.1.4.1 (B:) automated matches {Solanum lycopersicum [TaxId: 4081]}
nplfspykmgkfnlshrvvlapmtrcralnnipqaalgeyyeqrataggflitegtmisp
tsagfphvpgiftkeqvrewkkivdvvhakgavifcqlwhvgrashevyqpagaapisst
ekpisnrwrilmpdgthgiypkpraigtyeisqvvedyrrsalnaieagfdgieihgahg
ylidqflkdgindrtdeyggslanrckfitqvvqavvsaigadrvgvrvspaidhldamd
snplslglavverlnkiqlhsgsklaylhvtqpseeeearlmrtlrnayqgtficsggyt
relgieavaqgdadlvsygrlfisnpdlvmriklnaplnkynrktfytqdpvvgytdypf
lq

SCOPe Domain Coordinates for d3hgsb_:

Click to download the PDB-style file with coordinates for d3hgsb_.
(The format of our PDB-style files is described here.)

Timeline for d3hgsb_: