Lineage for d3hgrb_ (3hgr B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080008Protein 12-oxophytodienoate reductase (OPR, OYE homolog) [63896] (3 species)
  7. 2080016Species Tomato (Lycopersicon esculentum), OPR1 [TaxId:4081] [63897] (4 PDB entries)
  8. 2080024Domain d3hgrb_: 3hgr B: [177556]
    automated match to d1icpb_
    complexed with fmn, phb

Details for d3hgrb_

PDB Entry: 3hgr (more details), 2.3 Å

PDB Description: crystal structure of tomato opr1 in complex with phb
PDB Compounds: (B:) 12-oxophytodienoate reductase 1

SCOPe Domain Sequences for d3hgrb_:

Sequence, based on SEQRES records: (download)

>d3hgrb_ c.1.4.1 (B:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]}
qvdkiplmspckmgkfelchrvvlapltrqrsygyipqphailhysqrstngglligeat
visetgigykdvpgiwtkeqveawkpivdavhakggiffcqiwhvgrvsnkdfqpngedp
isctdrgltpqimsngidiahftrprrlttdeipqivnefrvaarnaieagfdgveihga
hgylidqfmkdqvndrsdkyggslenrcrfaleiveavaneigsdrvgirispfahynea
gdtnptalglymveslnkydlaychvveprmktawekiecteslvpmrkaykgtfivagg
ydredgnraliedradlvaygrlfisnpdlpkrfelnaplnkynrdtfytsdpivgytdy
pfle

Sequence, based on observed residues (ATOM records): (download)

>d3hgrb_ c.1.4.1 (B:) 12-oxophytodienoate reductase (OPR, OYE homolog) {Tomato (Lycopersicon esculentum), OPR1 [TaxId: 4081]}
qvdkiplmspckmgkfelchrvvlapltrqrsygyipqphailhysqrstngglligeat
visetgigykdvpgiwtkeqveawkpivdavhakggiffcqiwhvgrvsnkdfqpngedp
isctdrgltpqimsngidiahftrprrlttdeipqivnefrvaarnaieagfdgveihga
hgylidqfmkdqvndrsdkyggslenrcrfaleiveavaneigsdrvgirispfahynea
gdtnptalglymveslnkydlaychvveprteslvpmrkaykgtfivaggydredgnral
iedradlvaygrlfisnpdlpkrfelnaplnkynrdtfytsdpivgytdypfle

SCOPe Domain Coordinates for d3hgrb_:

Click to download the PDB-style file with coordinates for d3hgrb_.
(The format of our PDB-style files is described here.)

Timeline for d3hgrb_: