Lineage for d3hgna_ (3hgn A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1545908Protein Elastase [50536] (4 species)
  7. 1545919Species Pig (Sus scrofa) [TaxId:9823] [50538] (116 PDB entries)
  8. 1545965Domain d3hgna_: 3hgn A: [177551]
    automated match to d1c1ma_
    complexed with ca, dod, frw, so4

Details for d3hgna_

PDB Entry: 3hgn (more details), 1.65 Å

PDB Description: Structure of porcine pancreatic elastase complexed with a potent peptidyl inhibitor FR130180 determined by neutron crystallography
PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d3hgna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hgna_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d3hgna_:

Click to download the PDB-style file with coordinates for d3hgna_.
(The format of our PDB-style files is described here.)

Timeline for d3hgna_: