SCOPe 2.05: Domain d3hg6a_: 3hg6 A:

Lineage for d3hg6a_ (3hg6 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein Amphibian cytotoxic ribonuclease [54084] (5 species)

7. Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)

8. Domain d3hg6a_: 3hg6 A: [177542]
   automated match to d1onca_
   complexed with gol, so4

Details for d3hg6a_

PDB Entry: 3hg6, 1.7 Å

PDB Description: crystal structure of the recombinant onconase from rana pipiens

PDB Compounds: (A:) Onconase

SCOPe Domain Sequences for d3hg6a_:

Sequence; same for both SEQRES and ATOM records:

>d3hg6a_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

Timeline for d3hg6a_:

• d3hg6a_ first appeared in SCOPe 2.01
  
• d3hg6a_ appears in SCOPe 2.04
  
• d3hg6a_ is called d3hg6a1 in SCOPe 2.06
  
• d3hg6a_ appears in the current release, SCOPe 2.08, called d3hg6a1