SCOPe 2.01: Domain d3hfkc_: 3hfk C:

Lineage for d3hfkc_ (3hfk C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.19: MmlI-like [160292] (2 proteins)
   Pfam PF09448; Methylmuconolactone methyl-isomerase

6. Protein automated matches [191090] (1 species)
   not a true protein

7. Species Pseudomonas reinekei [TaxId:395598] [189060] (3 PDB entries)

8. Domain d3hfkc_: 3hfk C: [177538]
   automated match to d2ifxb1
   complexed with 4ml

Details for d3hfkc_

PDB Entry: 3hfk, 1.9 Å

PDB Description: crystal structure of 4-methylmuconolactone methylisomerase (h52a) in complex with 4-methylmuconolactone

PDB Compounds: (C:) 4-methylmuconolactone methylisomerase

SCOPe Domain Sequences for d3hfkc_:

Sequence; same for both SEQRES and ATOM records:

>d3hfkc_ d.58.4.19 (C:) automated matches {Pseudomonas reinekei [TaxId: 395598]}
grmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdtavpyldv
gridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv

Timeline for d3hfkc_:

• d3hfkc_ is new in SCOPe 2.01-stable
  
• d3hfkc_ appears in SCOPe 2.02
  
• d3hfkc_ appears in the current release, SCOPe 2.08, called d3hfkc1