Lineage for d3hfjb_ (3hfj B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2442470Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2442471Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2442769Family c.26.1.3: Adenylyltransferase [52397] (6 protein domains)
  6. 2442926Protein automated matches [190964] (6 species)
    not a true protein
  7. 2442927Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188590] (5 PDB entries)
  8. 2442933Domain d3hfjb_: 3hfj B: [177535]
    automated match to d1kama_
    complexed with ca, dz9

Details for d3hfjb_

PDB Entry: 3hfj (more details), 2.02 Å

PDB Description: Bacillus anthracis nicotinate mononucleotide adenylytransferase (nadD) in complex with inhibitor CID 3289443
PDB Compounds: (B:) Nicotinate (Nicotinamide) nucleotide adenylyltransferase

SCOPe Domain Sequences for d3hfjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hfjb_ c.26.1.3 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mrkigiiggtfdpphyghllianevyhalnleevwflpnqipphkqgrnitsvesrlqml
elateaeehfsicleelsrkgpsytydtmlqltkkypdvqfhfiiggdmveylpkwynie
alldlvtfvgvarpgyklrtpypittveipefavsssllrerykekktckyllpekvqvy
iernglyes

SCOPe Domain Coordinates for d3hfjb_:

Click to download the PDB-style file with coordinates for d3hfjb_.
(The format of our PDB-style files is described here.)

Timeline for d3hfjb_: