SCOPe 2.08: Domain d1g6wc1: 1g6w C:201-354

Lineage for d1g6wc1 (1g6w C:201-354)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)
   similar to class phi enzymes

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries)

8. Domain d1g6wc1: 1g6w C:201-354 [17753]
   Other proteins in same PDB: d1g6wa2, d1g6wb2, d1g6wc2, d1g6wd2

Details for d1g6wc1

PDB Entry: 1g6w, 2.5 Å

PDB Description: crystal structure of the globular region of the prion protein ure2 from the yeast saccaromyces cerevisiae

PDB Compounds: (C:) ure2 protein

SCOPe Domain Sequences for d1g6wc1:

Sequence; same for both SEQRES and ATOM records:

>d1g6wc1 a.45.1.1 (C:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrge

Timeline for d1g6wc1:

• d1g6wc1 first appeared (with stable ids) in SCOP 1.55
  
• d1g6wc1 appears in SCOPe 2.07