SCOPe 2.05: Domain d1hqob1: 1hqo B:201-354

Lineage for d1hqob1 (1hqo B:201-354)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)
   similar to class phi enzymes

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (8 PDB entries)

8. Domain d1hqob1: 1hqo B:201-354 [17750]
   Other proteins in same PDB: d1hqoa2, d1hqob2

Details for d1hqob1

PDB Entry: 1hqo, 2.3 Å

PDB Description: crystal structure of the nitrogen regulation fragment of the yeast prion protein ure2p

PDB Compounds: (B:) ure2 protein

SCOPe Domain Sequences for d1hqob1:

Sequence, based on SEQRES records:

>d1hqob1 a.45.1.1 (B:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrge

Sequence, based on observed residues (ATOM records):

>d1hqob1 a.45.1.1 (B:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmfdypvwlvgdkltiadlafvpwnnvvdriginikiefpevykwtkhmm
rrpavikalrge

Timeline for d1hqob1:

• d1hqob1 first appeared (with stable ids) in SCOP 1.55
  
• d1hqob1 appears in SCOPe 2.04
  
• d1hqob1 appears in SCOPe 2.06
  
• d1hqob1 appears in the current release, SCOPe 2.08