Lineage for d1hqob1 (1hqo B:201-354)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3694Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)
  4. 3695Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) (S)
  5. 3696Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)
  6. 3954Protein Yeast prion protein ure2p, nitrogen regulation fragment [47641] (1 species)
  7. 3955Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47642] (3 PDB entries)
  8. 3957Domain d1hqob1: 1hqo B:201-354 [17750]
    Other proteins in same PDB: d1hqoa2, d1hqob2

Details for d1hqob1

PDB Entry: 1hqo (more details), 2.3 Å

PDB Description: crystal structure of the nitrogen regulation fragment of the yeast prion protein ure2p

SCOP Domain Sequences for d1hqob1:

Sequence, based on SEQRES records: (download)

>d1hqob1 a.45.1.1 (B:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmeldtenaaaysagttpmsqsrffdypvwlvgdkltiadlafvpwnnvv
driginikiefpevykwtkhmmrrpavikalrge

Sequence, based on observed residues (ATOM records): (download)

>d1hqob1 a.45.1.1 (B:201-354) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
lwsddladqsqinawlffqtsghapmigqalhfryfhsqkiasaverytdevrrvygvve
malaerrealvmfdypvwlvgdkltiadlafvpwnnvvdriginikiefpevykwtkhmm
rrpavikalrge

SCOP Domain Coordinates for d1hqob1:

Click to download the PDB-style file with coordinates for d1hqob1.
(The format of our PDB-style files is described here.)

Timeline for d1hqob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hqob2