Lineage for d3hf5d_ (3hf5 D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1026927Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 1027193Family d.58.4.19: MmlI-like [160292] (2 proteins)
    Pfam PF09448; Methylmuconolactone methyl-isomerase
  6. 1027198Protein automated matches [191090] (1 species)
    not a true protein
  7. 1027199Species Pseudomonas reinekei [TaxId:395598] [189060] (3 PDB entries)
  8. 1027203Domain d3hf5d_: 3hf5 D: [177467]
    automated match to d2ifxa1
    complexed with 3ml

Details for d3hf5d_

PDB Entry: 3hf5 (more details), 1.4 Å

PDB Description: Crystal structure of 4-methylmuconolactone methylisomerase in complex with 3-methylmuconolactone
PDB Compounds: (D:) 4-methylmuconolactone methylisomerase

SCOPe Domain Sequences for d3hf5d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hf5d_ d.58.4.19 (D:) automated matches {Pseudomonas reinekei [TaxId: 395598]}
grmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdthvpyldv
gridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv

SCOPe Domain Coordinates for d3hf5d_:

Click to download the PDB-style file with coordinates for d3hf5d_.
(The format of our PDB-style files is described here.)

Timeline for d3hf5d_: