Lineage for d3hf5a1 (3hf5 A:1-107)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2950104Family d.58.4.19: MmlI-like [160292] (2 proteins)
    Pfam PF09448; Methylmuconolactone methyl-isomerase
  6. 2950109Protein automated matches [191090] (1 species)
    not a true protein
  7. 2950110Species Pseudomonas reinekei [TaxId:395598] [189060] (3 PDB entries)
  8. 2950111Domain d3hf5a1: 3hf5 A:1-107 [177464]
    Other proteins in same PDB: d3hf5a2, d3hf5b2, d3hf5c2, d3hf5d2
    automated match to d2ifxa1
    complexed with 3ml

Details for d3hf5a1

PDB Entry: 3hf5 (more details), 1.4 Å

PDB Description: Crystal structure of 4-methylmuconolactone methylisomerase in complex with 3-methylmuconolactone
PDB Compounds: (A:) 4-methylmuconolactone methylisomerase

SCOPe Domain Sequences for d3hf5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hf5a1 d.58.4.19 (A:1-107) automated matches {Pseudomonas reinekei [TaxId: 395598]}
mirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdthvpyldvgr
idaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv

SCOPe Domain Coordinates for d3hf5a1:

Click to download the PDB-style file with coordinates for d3hf5a1.
(The format of our PDB-style files is described here.)

Timeline for d3hf5a1: