Lineage for d3hf4b_ (3hf4 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2301856Protein automated matches [190359] (44 species)
    not a true protein
  7. 2302205Species Norway rat (Rattus norvegicus) [TaxId:10116] [188924] (2 PDB entries)
  8. 2302207Domain d3hf4b_: 3hf4 B: [177461]
    automated match to d1jebd_
    complexed with hem

Details for d3hf4b_

PDB Entry: 3hf4 (more details), 2.7 Å

PDB Description: crystal structure of rat methemoglobin in r2 state
PDB Compounds: (B:) Hemoglobin subunit beta-1

SCOPe Domain Sequences for d3hf4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hf4b_ a.1.1.2 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vhltdaekaavnglwgkvnpddvggealgrllvvypwtqryfdsfgdlssasaimgnpkv
kahgkkvinafndglkhldnlkgtfahlselhcdklhvdpenfrllgnmivivlghhlgk
eftpcaqaafqkvvagvasalahky

SCOPe Domain Coordinates for d3hf4b_:

Click to download the PDB-style file with coordinates for d3hf4b_.
(The format of our PDB-style files is described here.)

Timeline for d3hf4b_: