| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
| Protein automated matches [190359] (43 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [188924] (2 PDB entries) |
| Domain d3hf4b_: 3hf4 B: [177461] automated match to d1jebd_ complexed with hem |
PDB Entry: 3hf4 (more details), 2.7 Å
SCOPe Domain Sequences for d3hf4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hf4b_ a.1.1.2 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vhltdaekaavnglwgkvnpddvggealgrllvvypwtqryfdsfgdlssasaimgnpkv
kahgkkvinafndglkhldnlkgtfahlselhcdklhvdpenfrllgnmivivlghhlgk
eftpcaqaafqkvvagvasalahky
Timeline for d3hf4b_: