Lineage for d3hf4a_ (3hf4 A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903724Species Norway rat (Rattus norvegicus) [TaxId:10116] [188924] (2 PDB entries)
  8. 903725Domain d3hf4a_: 3hf4 A: [177460]
    automated match to d1fhja_
    complexed with hem

Details for d3hf4a_

PDB Entry: 3hf4 (more details), 2.7 Å

PDB Description: crystal structure of rat methemoglobin in r2 state
PDB Compounds: (A:) Hemoglobin subunit alpha-1/2

SCOPe Domain Sequences for d3hf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hf4a_ a.1.1.2 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vlsaddktnikncwgkigghggeygeealqrmfaafpttktyfshidvspgsaqvkahgk
kvadalakaadhvedlpgalstlsdlhahklrvdpvnfkflshcllvtlachhpgdftpa
mhasldkflasvstvltskyr

SCOPe Domain Coordinates for d3hf4a_:

Click to download the PDB-style file with coordinates for d3hf4a_.
(The format of our PDB-style files is described here.)

Timeline for d3hf4a_: