SCOPe 2.05: Domain d3hf3c_: 3hf3 C:

Lineage for d3hf3c_ (3hf3 C:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.0: automated matches [191310] (1 protein)
   not a true family

6. Protein automated matches [190048] (17 species)
   not a true protein

7. Species Thermus scotoductus [TaxId:37636] [189238] (2 PDB entries)

8. Domain d3hf3c_: 3hf3 C: [177458]
   automated match to d1z41a1
   complexed with fmn, so4

Details for d3hf3c_

PDB Entry: 3hf3, 2.2 Å

PDB Description: Old Yellow Enzyme from Thermus scotoductus SA-01

PDB Compounds: (C:) Chromate reductase

SCOPe Domain Sequences for d3hf3c_:

Sequence; same for both SEQRES and ATOM records:

>d3hf3c_ c.1.4.0 (C:) automated matches {Thermus scotoductus [TaxId: 37636]}
allftplelgglrlknrlamspmcqysatlegevtdwhllhyptralggvglilveatav
eplgrispydlgiwsedhlpglkelarrireagavpgiqlahagrkagtarpweggkplg
wrvvgpspipfdegypvpepldeagmerilqafvegarralragfqvielhmahgyllss
flsplsnqrtdayggslenrmrfplqvaqavrevvprelplfvrvsatdwgeggwsledt
lafarrlkelgvdlldcssggvvlrvriplapgfqvpfadavrkrvglrtgavglittpe
qaetllqagsadlvllgrvllrdpyfplraakalgvapevppqyqrgf

Timeline for d3hf3c_:

• d3hf3c_ first appeared in SCOPe 2.01
  
• d3hf3c_ appears in SCOPe 2.04
  
• d3hf3c_ appears in SCOPe 2.06
  
• d3hf3c_ appears in the current release, SCOPe 2.08