Lineage for d3heoa_ (3heo A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1474672Protein Myoglobin [46469] (9 species)
  7. 1474677Species Horse (Equus caballus) [TaxId:9796] [46474] (65 PDB entries)
  8. 1474739Domain d3heoa_: 3heo A: [177454]
    automated match to d1bjea_
    complexed with hem, no2; mutant

Details for d3heoa_

PDB Entry: 3heo (more details), 2 Å

PDB Description: ferric horse heart myoglobin; h64v/v67r mutant, nitrite modified
PDB Compounds: (A:) Myoglobin

SCOPe Domain Sequences for d3heoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3heoa_ a.1.1.2 (A:) Myoglobin {Horse (Equus caballus) [TaxId: 9796]}
glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
lkkvgtrvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
gdfgadaqgamtkalelfrndiaakykelgfqg

SCOPe Domain Coordinates for d3heoa_:

Click to download the PDB-style file with coordinates for d3heoa_.
(The format of our PDB-style files is described here.)

Timeline for d3heoa_: