| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries) |
| Domain d3heio_: 3hei O: [177444] Other proteins in same PDB: d3heib1, d3heib2, d3heid1, d3heid2, d3heif1, d3heif2, d3heih1, d3heih2, d3heij1, d3heij2, d3heil1, d3heil2, d3hein1, d3hein2, d3heip1, d3heip2 automated match to d1kgya_ |
PDB Entry: 3hei (more details), 2 Å
SCOPe Domain Sequences for d3heio_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3heio_ b.18.1.0 (O:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwvy
rgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtiap
deitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc
Timeline for d3heio_: