SCOPe 2.08: Domain d3hein1: 3hei N:18-147

Lineage for d3hein1 (3hei N:18-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)

8. Domain d3hein1: 3hei N:18-147 [177443]
   Other proteins in same PDB: d3heia_, d3heib2, d3heic_, d3heid2, d3heie_, d3heif2, d3heig_, d3heih2, d3heii_, d3heij2, d3heik_, d3heil2, d3heim_, d3hein2, d3heio_, d3heip2
   automated match to d1shwa_

Details for d3hein1

PDB Entry: 3hei, 2 Å

PDB Description: ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex

PDB Compounds: (N:) Ephrin-A1

SCOPe Domain Sequences for d3hein1:

Sequence; same for both SEQRES and ATOM records:

>d3hein1 b.6.1.0 (N:18-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adrhtvfwnssnpkfrnedytihvqlndyvdiicphyedhsvadaameqyilylveheey
qlcqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhe
drclrlkvtv

Timeline for d3hein1:

• d3hein1 first appeared in SCOPe 2.01, called d3hein_
  
• d3hein1 appears in SCOPe 2.07