Lineage for d3heii_ (3hei I:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942722Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 942723Protein automated matches [190770] (6 species)
    not a true protein
  7. 942737Species Human (Homo sapiens) [TaxId:9606] [188939] (3 PDB entries)
  8. 942743Domain d3heii_: 3hei I: [177438]
    Other proteins in same PDB: d3heib_, d3heid_, d3heif_, d3heih_, d3heij_, d3heil_, d3hein_, d3heip_
    automated match to d1kgya_

Details for d3heii_

PDB Entry: 3hei (more details), 2 Å

PDB Description: ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex
PDB Compounds: (I:) Ephrin type-A receptor 2

SCOPe Domain Sequences for d3heii_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3heii_ b.18.1.0 (I:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evvlldfaaaggelgwlthpygkgwdlmqnimndmpiymysvcnvmsgdqdnwlrtnwvy
rgeaerifielkftvrdcnsfpggasscketfnlyyaesdldygtnfqkrlftkidtiap
deitvssdfearhvklnveersvgpltrkgfylafqdigacvallsvrvyykkc

SCOPe Domain Coordinates for d3heii_:

Click to download the PDB-style file with coordinates for d3heii_.
(The format of our PDB-style files is described here.)

Timeline for d3heii_: