Lineage for d3heih_ (3hei H:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 940170Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 940171Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 941282Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 941283Protein automated matches [190824] (3 species)
    not a true protein
  7. 941289Species Human (Homo sapiens) [TaxId:9606] [188940] (1 PDB entry)
  8. 941293Domain d3heih_: 3hei H: [177437]
    Other proteins in same PDB: d3heia_, d3heic_, d3heie_, d3heig_, d3heii_, d3heik_, d3heim_, d3heio_
    automated match to d1shwa_

Details for d3heih_

PDB Entry: 3hei (more details), 2 Å

PDB Description: ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex
PDB Compounds: (H:) Ephrin-A1

SCOPe Domain Sequences for d3heih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3heih_ b.6.1.0 (H:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adrhtvfwnssnpkfrnedytihvqlndyvdiicphyedhsvadaameqyilylveheey
qlcqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhe
drclrlkvtvki

SCOPe Domain Coordinates for d3heih_:

Click to download the PDB-style file with coordinates for d3heih_.
(The format of our PDB-style files is described here.)

Timeline for d3heih_: