Lineage for d3heif1 (3hei F:18-147)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772201Family b.6.1.0: automated matches [191502] (1 protein)
    not a true family
  6. 2772202Protein automated matches [190824] (31 species)
    not a true protein
  7. 2772475Species Human (Homo sapiens) [TaxId:9606] [188940] (31 PDB entries)
  8. 2772486Domain d3heif1: 3hei F:18-147 [177435]
    Other proteins in same PDB: d3heia_, d3heib2, d3heic_, d3heid2, d3heie_, d3heif2, d3heig_, d3heih2, d3heii_, d3heij2, d3heik_, d3heil2, d3heim_, d3hein2, d3heio_, d3heip2
    automated match to d1shwa_

Details for d3heif1

PDB Entry: 3hei (more details), 2 Å

PDB Description: ligand recognition by a-class eph receptors: crystal structures of the epha2 ligand-binding domain and the epha2/ephrin-a1 complex
PDB Compounds: (F:) Ephrin-A1

SCOPe Domain Sequences for d3heif1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3heif1 b.6.1.0 (F:18-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adrhtvfwnssnpkfrnedytihvqlndyvdiicphyedhsvadaameqyilylveheey
qlcqpqskdqvrwqcnrpsakhgpeklsekfqrftpftlgkefkeghsyyyiskpihqhe
drclrlkvtv

SCOPe Domain Coordinates for d3heif1:

Click to download the PDB-style file with coordinates for d3heif1.
(The format of our PDB-style files is described here.)

Timeline for d3heif1: