SCOPe 2.06: Domain d3hebb1: 3heb B:8-147

Lineage for d3hebb1 (3heb B:8-147)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:269796] [188910] (1 PDB entry)

8. Domain d3hebb1: 3heb B:8-147 [177427]
   Other proteins in same PDB: d3heba2, d3hebb2
   automated match to d1k68a_
   complexed with po4

Details for d3hebb1

PDB Entry: 3heb, 2.4 Å

PDB Description: crystal structure of response regulator receiver domain from rhodospirillum rubrum

PDB Compounds: (B:) Response regulator receiver domain protein (CheY)

SCOPe Domain Sequences for d3hebb1:

Sequence; same for both SEQRES and ATOM records:

>d3hebb1 c.23.1.0 (B:8-147) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
vtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagraqlvl
ldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpvnyen
fanairqlglffsvmqvpet

Timeline for d3hebb1:

• d3hebb1 first appeared in SCOPe 2.01, called d3hebb_
  
• d3hebb1 was called d3hebb_ in SCOPe 2.05
  
• d3hebb1 appears in SCOPe 2.07
  
• d3hebb1 appears in the current release, SCOPe 2.08