| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (59 species) not a true protein |
| Species Rhodospirillum rubrum [TaxId:269796] [188910] (1 PDB entry) |
| Domain d3hebb_: 3heb B: [177427] automated match to d1k68a_ complexed with po4 |
PDB Entry: 3heb (more details), 2.4 Å
SCOPe Domain Sequences for d3hebb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hebb_ c.23.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
vtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagraqlvl
ldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpvnyen
fanairqlglffsvmqvpeteg
Timeline for d3hebb_: