Lineage for d3hebb_ (3heb B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 982187Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 982188Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 982514Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 982515Protein automated matches [190131] (16 species)
    not a true protein
  7. 982558Species Rhodospirillum rubrum [TaxId:269796] [188910] (1 PDB entry)
  8. 982560Domain d3hebb_: 3heb B: [177427]
    automated match to d1k68a_
    complexed with po4

Details for d3hebb_

PDB Entry: 3heb (more details), 2.4 Å

PDB Description: crystal structure of response regulator receiver domain from rhodospirillum rubrum
PDB Compounds: (B:) Response regulator receiver domain protein (CheY)

SCOPe Domain Sequences for d3hebb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hebb_ c.23.1.0 (B:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
vtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagraqlvl
ldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpvnyen
fanairqlglffsvmqvpeteg

SCOPe Domain Coordinates for d3hebb_:

Click to download the PDB-style file with coordinates for d3hebb_.
(The format of our PDB-style files is described here.)

Timeline for d3hebb_: