Lineage for d3hebb1 (3heb B:8-147)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856107Species Rhodospirillum rubrum [TaxId:269796] [188910] (1 PDB entry)
  8. 2856109Domain d3hebb1: 3heb B:8-147 [177427]
    Other proteins in same PDB: d3heba2, d3hebb2
    automated match to d1k68a_
    complexed with po4

Details for d3hebb1

PDB Entry: 3heb (more details), 2.4 Å

PDB Description: crystal structure of response regulator receiver domain from rhodospirillum rubrum
PDB Compounds: (B:) Response regulator receiver domain protein (CheY)

SCOPe Domain Sequences for d3hebb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hebb1 c.23.1.0 (B:8-147) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
vtivmieddlgharlieknirragvnneiiaftdgtsalnylfgddksgrvsagraqlvl
ldlnlpdmtgidilklvkenphtrrspvviltttddqreiqrcydlganvyitkpvnyen
fanairqlglffsvmqvpet

SCOPe Domain Coordinates for d3hebb1:

Click to download the PDB-style file with coordinates for d3hebb1.
(The format of our PDB-style files is described here.)

Timeline for d3hebb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hebb2