Lineage for d3heae_ (3hea E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2151524Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
    automatically mapped to Pfam PF12697
    automatically mapped to Pfam PF00561
  6. 2151561Protein automated matches [190860] (3 species)
    not a true protein
  7. 2151566Species Pseudomonas fluorescens [TaxId:294] [189239] (5 PDB entries)
  8. 2151577Domain d3heae_: 3hea E: [177424]
    automated match to d1va4a_
    complexed with eee, gol, so4; mutant

Details for d3heae_

PDB Entry: 3hea (more details), 1.9 Å

PDB Description: the l29p/l124i mutation of pseudomonas fluorescens esterase
PDB Compounds: (E:) Arylesterase

SCOPe Domain Sequences for d3heae_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3heae_ c.69.1.12 (E:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
stfvakdgtqiyfkdwgsgkpvlfshgwpldadmweyqmeylssrgyrtiafdrrgfgrs
dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
vtpifgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
aelkvykdaphgfavthaqqlnedllaflkr

SCOPe Domain Coordinates for d3heae_:

Click to download the PDB-style file with coordinates for d3heae_.
(The format of our PDB-style files is described here.)

Timeline for d3heae_: