SCOPe 2.06: Domain d3heae_: 3hea E:

Lineage for d3heae_ (3hea E:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.12: Haloperoxidase [53531] (8 proteins)
   automatically mapped to Pfam PF12697
   automatically mapped to Pfam PF00561

6. Protein automated matches [190860] (3 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:294] [189239] (5 PDB entries)

8. Domain d3heae_: 3hea E: [177424]
   automated match to d1va4a_
   complexed with eee, gol, so4; mutant

Details for d3heae_

PDB Entry: 3hea, 1.9 Å

PDB Description: the l29p/l124i mutation of pseudomonas fluorescens esterase

PDB Compounds: (E:) Arylesterase

SCOPe Domain Sequences for d3heae_:

Sequence; same for both SEQRES and ATOM records:

>d3heae_ c.69.1.12 (E:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
stfvakdgtqiyfkdwgsgkpvlfshgwpldadmweyqmeylssrgyrtiafdrrgfgrs
dqpwtgndydtfaddiaqliehldlkevtlvgfsmgggdvaryiarhgsarvaglvllga
vtpifgqkpdypqgvpldvfarfktellkdraqfisdfnapfyginkgqvvsqgvqtqtl
qiallaslkatvdcvtafaetdfrpdmakidvptlvihgdgdqivpfettgkvaaelikg
aelkvykdaphgfavthaqqlnedllaflkr

Timeline for d3heae_:

• d3heae_ first appeared in SCOPe 2.01
  
• d3heae_ appears in SCOPe 2.05
  
• d3heae_ appears in SCOPe 2.07
  
• d3heae_ appears in the current release, SCOPe 2.08