Lineage for d2pmtb1 (2pmt B:81-201)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713010Protein Class beta GST [81357] (4 species)
  7. 2713020Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries)
  8. 2713022Domain d2pmtb1: 2pmt B:81-201 [17742]
    Other proteins in same PDB: d2pmta2, d2pmtb2, d2pmtc2, d2pmtd2
    complexed with gsh

Details for d2pmtb1

PDB Entry: 2pmt (more details), 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis
PDB Compounds: (B:) glutathione transferase

SCOPe Domain Sequences for d2pmtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pmtb1 a.45.1.1 (B:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i

SCOPe Domain Coordinates for d2pmtb1:

Click to download the PDB-style file with coordinates for d2pmtb1.
(The format of our PDB-style files is described here.)

Timeline for d2pmtb1: