SCOPe 2.02: Domain d3hdvd_: 3hdv D:

Lineage for d3hdvd_ (3hdv D:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (17 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [188909] (1 PDB entry)

8. Domain d3hdvd_: 3hdv D: [177416]
   automated match to d1d5wa_

Details for d3hdvd_

PDB Entry: 3hdv, 2.09 Å

PDB Description: crystal structure of response regulator receiver protein from pseudomonas putida

PDB Compounds: (D:) Response regulator

SCOPe Domain Sequences for d3hdvd_:

Sequence; same for both SEQRES and ATOM records:

>d3hdvd_ c.23.1.0 (D:) automated matches {Pseudomonas putida [TaxId: 160488]}
plvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlrmqpesg
ldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelvnke

Timeline for d3hdvd_:

• d3hdvd_ first appeared in SCOPe 2.01
  
• d3hdvd_ appears in SCOPe 2.03
  
• d3hdvd_ appears in the current release, SCOPe 2.08