SCOPe 2.07: Domain d3hdvb1: 3hdv B:65-188

Lineage for d3hdvb1 (3hdv B:65-188)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (84 species)
   not a true protein

7. Species Pseudomonas putida [TaxId:160488] [188909] (1 PDB entry)

8. Domain d3hdvb1: 3hdv B:65-188 [177414]
   Other proteins in same PDB: d3hdvb2
   automated match to d1d5wa_

Details for d3hdvb1

PDB Entry: 3hdv, 2.09 Å

PDB Description: crystal structure of response regulator receiver protein from pseudomonas putida

PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d3hdvb1:

Sequence; same for both SEQRES and ATOM records:

>d3hdvb1 c.23.1.0 (B:65-188) automated matches {Pseudomonas putida [TaxId: 160488]}
vaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlrmq
pesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelvnk
elki

Timeline for d3hdvb1:

• d3hdvb1 first appeared in SCOPe 2.01, called d3hdvb_
  
• d3hdvb1 appears in SCOPe 2.06
  
• d3hdvb1 appears in the current release, SCOPe 2.08