Lineage for d3hdvb_ (3hdv B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1158037Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1158378Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1158379Protein automated matches [190131] (17 species)
    not a true protein
  7. 1158420Species Pseudomonas putida [TaxId:160488] [188909] (1 PDB entry)
  8. 1158422Domain d3hdvb_: 3hdv B: [177414]
    automated match to d1d5wa_

Details for d3hdvb_

PDB Entry: 3hdv (more details), 2.09 Å

PDB Description: crystal structure of response regulator receiver protein from pseudomonas putida
PDB Compounds: (B:) Response regulator

SCOPe Domain Sequences for d3hdvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdvb_ c.23.1.0 (B:) automated matches {Pseudomonas putida [TaxId: 160488]}
slvaarplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlr
mqpesgldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelv
nkelki

SCOPe Domain Coordinates for d3hdvb_:

Click to download the PDB-style file with coordinates for d3hdvb_.
(The format of our PDB-style files is described here.)

Timeline for d3hdvb_: