| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
| Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
| Protein automated matches [190131] (86 species) not a true protein |
| Species Pseudomonas putida [TaxId:160488] [188909] (1 PDB entry) |
| Domain d3hdva_: 3hdv A: [177413] Other proteins in same PDB: d3hdvb2 automated match to d1d5wa_ |
PDB Entry: 3hdv (more details), 2.09 Å
SCOPe Domain Sequences for d3hdva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdva_ c.23.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}
rplvlvvddnavnrealilylksrgidavgadgaeearlylhyqkriglmitdlrmqpes
gldlirtiraseraalsiivvsgdtdveeavdvmhlgvvdfllkpvdlgkllelvnkelk
Timeline for d3hdva_:
View in 3DDomains from other chains: (mouse over for more information) d3hdvb1, d3hdvb2, d3hdvc_, d3hdvd_ |