SCOPe 2.03: Domain d3hdsd_: 3hds D:

Lineage for d3hdsd_ (3hds D:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.19: MmlI-like [160292] (2 proteins)
   Pfam PF09448; Methylmuconolactone methyl-isomerase

6. Protein automated matches [191090] (1 species)
   not a true protein

7. Species Pseudomonas reinekei [TaxId:395598] [189060] (3 PDB entries)

8. Domain d3hdsd_: 3hds D: [177412]
   automated match to d2ifxa1
   complexed with mes

Details for d3hdsd_

PDB Entry: 3hds, 1.45 Å

PDB Description: Crystal structure of 4-methylmuconolactone methylisomerase in complex with MES

PDB Compounds: (D:) 4-methylmuconolactone methylisomerase

SCOPe Domain Sequences for d3hdsd_:

Sequence; same for both SEQRES and ATOM records:

>d3hdsd_ d.58.4.19 (D:) automated matches {Pseudomonas reinekei [TaxId: 395598]}
grmirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdthvpyldv
gridaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv

Timeline for d3hdsd_:

• d3hdsd_ first appeared in SCOPe 2.01
  
• d3hdsd_ appears in SCOPe 2.02
  
• d3hdsd_ appears in SCOPe 2.04
  
• d3hdsd_ appears in the current release, SCOPe 2.08, called d3hdsd1