SCOPe 2.08: Domain d3hdsc1: 3hds C:1-107

Lineage for d3hdsc1 (3hds C:1-107)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.19: MmlI-like [160292] (2 proteins)
   Pfam PF09448; Methylmuconolactone methyl-isomerase

6. Protein automated matches [191090] (1 species)
   not a true protein

7. Species Pseudomonas reinekei [TaxId:395598] [189060] (3 PDB entries)

8. Domain d3hdsc1: 3hds C:1-107 [177411]
   Other proteins in same PDB: d3hdsa2, d3hdsb2, d3hdsc2, d3hdsd2
   automated match to d2ifxa1
   complexed with mes

Details for d3hdsc1

PDB Entry: 3hds, 1.45 Å

PDB Description: Crystal structure of 4-methylmuconolactone methylisomerase in complex with MES

PDB Compounds: (C:) 4-methylmuconolactone methylisomerase

SCOPe Domain Sequences for d3hdsc1:

Sequence; same for both SEQRES and ATOM records:

>d3hdsc1 d.58.4.19 (C:1-107) automated matches {Pseudomonas reinekei [TaxId: 395598]}
mirilyllvkpesmsheqfrkecvvhfqmsagmpglhkyevrlvagnptdthvpyldvgr
idaigecwfaseeqyqvymesdirkawfehgkyfigqlkpfvteelv

Timeline for d3hdsc1:

• d3hdsc1 first appeared in SCOPe 2.01, called d3hdsc_
  
• d3hdsc1 appears in SCOPe 2.07