SCOPe 2.08: Domain d2pmta1: 2pmt A:81-201

Lineage for d2pmta1 (2pmt A:81-201)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class beta GST [81357] (4 species)

7. Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries)

8. Domain d2pmta1: 2pmt A:81-201 [17741]
   Other proteins in same PDB: d2pmta2, d2pmtb2, d2pmtc2, d2pmtd2
   complexed with gsh

Details for d2pmta1

PDB Entry: 2pmt, 2.7 Å

PDB Description: glutathione transferase from proteus mirabilis

PDB Compounds: (A:) glutathione transferase

SCOPe Domain Sequences for d2pmta1:

Sequence; same for both SEQRES and ATOM records:

>d2pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i

Timeline for d2pmta1:

• d2pmta1 first appeared (with stable ids) in SCOP 1.55
  
• d2pmta1 appears in SCOPe 2.07