Lineage for d3hdga1 (3hdg A:8-130)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2855424Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2855811Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2855812Protein automated matches [190131] (86 species)
    not a true protein
  7. 2856192Species Wolinella succinogenes [TaxId:844] [188908] (1 PDB entry)
  8. 2856193Domain d3hdga1: 3hdg A:8-130 [177404]
    Other proteins in same PDB: d3hdga2, d3hdgb2, d3hdgd2, d3hdge2
    automated match to d1p6qa_
    complexed with mg

Details for d3hdga1

PDB Entry: 3hdg (more details), 2.27 Å

PDB Description: crystal structure of the n-terminal domain of an uncharacterized protein (ws1339) from wolinella succinogenes
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3hdga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hdga1 c.23.1.0 (A:8-130) automated matches {Wolinella succinogenes [TaxId: 844]}
alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg
lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik
lak

SCOPe Domain Coordinates for d3hdga1:

Click to download the PDB-style file with coordinates for d3hdga1.
(The format of our PDB-style files is described here.)

Timeline for d3hdga1: