![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
![]() | Protein automated matches [190131] (86 species) not a true protein |
![]() | Species Wolinella succinogenes [TaxId:844] [188908] (1 PDB entry) |
![]() | Domain d3hdga1: 3hdg A:8-130 [177404] Other proteins in same PDB: d3hdga2, d3hdgb2, d3hdgd2, d3hdge2 automated match to d1p6qa_ complexed with mg |
PDB Entry: 3hdg (more details), 2.27 Å
SCOPe Domain Sequences for d3hdga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hdga1 c.23.1.0 (A:8-130) automated matches {Wolinella succinogenes [TaxId: 844]} alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik lak
Timeline for d3hdga1: