SCOPe 2.08: Domain d3hdga1: 3hdg A:8-130

Lineage for d3hdga1 (3hdg A:8-130)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (86 species)
   not a true protein

7. Species Wolinella succinogenes [TaxId:844] [188908] (1 PDB entry)

8. Domain d3hdga1: 3hdg A:8-130 [177404]
   Other proteins in same PDB: d3hdga2, d3hdgb2, d3hdgd2, d3hdge2
   automated match to d1p6qa_
   complexed with mg

Details for d3hdga1

PDB Entry: 3hdg, 2.27 Å

PDB Description: crystal structure of the n-terminal domain of an uncharacterized protein (ws1339) from wolinella succinogenes

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d3hdga1:

Sequence; same for both SEQRES and ATOM records:

>d3hdga1 c.23.1.0 (A:8-130) automated matches {Wolinella succinogenes [TaxId: 844]}
alkiliveddtdarewlstiisnhfpevwsagdgeegerlfglhapdviitdirmpklgg
lemldrikaggakpyvivisafsemkyfikaielgvhlflpkpiepgrlmetledfrhik
lak

Timeline for d3hdga1:

• d3hdga1 first appeared in SCOPe 2.01, called d3hdga_
  
• d3hdga1 appears in SCOPe 2.07