| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.1: Papain-like [54002] (26 proteins) |
| Protein Cruzain [54020] (1 species) |
| Species Trypanosoma cruzi [TaxId:5693] [54021] (29 PDB entries) |
| Domain d3hd3b_: 3hd3 B: [177401] automated match to d1ewla_ complexed with 25b, edo, eoh, peg, so4 |
PDB Entry: 3hd3 (more details), 1.75 Å
SCOPe Domain Sequences for d3hd3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hd3b_ d.3.1.1 (B:) Cruzain {Trypanosoma cruzi [TaxId: 5693]}
apaavdwrargavtavkdqgqcgscwafsaignvecqwflaghpltnlaeqmlvscdktd
sgcsgglmnnafewivqenngavytedsypyasgegisppcttsghtvgatitghvelpq
deaqiaawlavngpvavavdasswmtytggvmtscvseqldhgvllvgyndgaavpywii
knswttqwgeegyiriakgsnqclvkeeassavv
Timeline for d3hd3b_: