Lineage for d1pmt_1 (1pmt 81-201)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily) Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family) 
Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins) Protein Glutathione S-transferase [47618] (22 species) 
Species Proteus mirabilis [TaxId:584] [47639] (2 PDB entries) 
Domain d1pmt_1: 1pmt 81-201 [17740]
Other proteins in same PDB: d1pmt_2
Details for d1pmt_1
PDB Entry: 1pmt (more details), 2.5 Å
PDB Description: glutathione transferase from proteus mirabilis
SCOP Domain Sequences for d1pmt_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pmt_1 a.45.1.1 (81-201) Glutathione S-transferase {Proteus mirabilis}
nliappkaleryhqiewlnflasevhkgysplfssdtpesylpvvknklkskfvyindvl
skqkcvcgdhftvadaylftlsqwaphvaldltdlshlqdylariaqrpnvhsalvtegl
i
SCOP Domain Coordinates for d1pmt_1:
Click to download the PDB-style file with coordinates for d1pmt_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pmt_1:
- d1pmt_1 appears in SCOP 1.57
- d1pmt_1 appears in the current release, SCOPe 2.08, called d1pmta1
View in 3D
