Lineage for d3hcxa_ (3hcx A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1029796Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 1029797Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein)
  6. 1029798Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species)
  7. 1029799Species Escherichia coli K-12 [TaxId:83333] [189336] (2 PDB entries)
  8. 1029801Domain d3hcxa_: 3hcx A: [177398]
    automated match to d1dy3a_
    complexed with cl, trs

Details for d3hcxa_

PDB Entry: 3hcx (more details), 1.75 Å

PDB Description: crystal structure of e. coli hppk(n10a)
PDB Compounds: (A:) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase

SCOPe Domain Sequences for d3hcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hcxa_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli K-12 [TaxId: 83333]}
tvayiaigsalaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

SCOPe Domain Coordinates for d3hcxa_:

Click to download the PDB-style file with coordinates for d3hcxa_.
(The format of our PDB-style files is described here.)

Timeline for d3hcxa_: