| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.30: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55083] (1 family) ![]() common fold is elaborated with additional secondary structures |
| Family d.58.30.1: 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55084] (1 protein) |
| Protein 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK [55085] (4 species) |
| Species Escherichia coli K-12 [TaxId:83333] [189336] (2 PDB entries) |
| Domain d3hcxa_: 3hcx A: [177398] automated match to d1dy3a_ complexed with cl, trs |
PDB Entry: 3hcx (more details), 1.75 Å
SCOPe Domain Sequences for d3hcxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hcxa_ d.58.30.1 (A:) 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK {Escherichia coli K-12 [TaxId: 83333]}
tvayiaigsalaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw
Timeline for d3hcxa_: