Lineage for d3hcub_ (3hcu B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021591Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1021592Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1021593Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 1021744Protein automated matches [190124] (8 species)
    not a true protein
  7. 1021750Species Human (Homo sapiens) [TaxId:9606] [186848] (14 PDB entries)
  8. 1021781Domain d3hcub_: 3hcu B: [177395]
    automated match to d1j7db_
    protein/DNA complex; complexed with zn

Details for d3hcub_

PDB Entry: 3hcu (more details), 2.6 Å

PDB Description: crystal structure of traf6 in complex with ubc13 in the c2 space group
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d3hcub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hcub_ d.20.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
glprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpeey
pmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpla
ndvaeqwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d3hcub_:

Click to download the PDB-style file with coordinates for d3hcub_.
(The format of our PDB-style files is described here.)

Timeline for d3hcub_: