Lineage for d1b8xa1 (1b8x A:81-260)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713010Protein Class beta GST [81357] (4 species)
  7. 2713011Species Escherichia coli [TaxId:562] [47638] (3 PDB entries)
  8. 2713016Domain d1b8xa1: 1b8x A:81-260 [17739]
    Other proteins in same PDB: d1b8xa2
    fused with nuclear matrix targeting signal of transcription factor AML-1

Details for d1b8xa1

PDB Entry: 1b8x (more details), 2.7 Å

PDB Description: glutathione s-transferase fused with the nuclear matrix targeting signal of the transcription factor aml-1
PDB Compounds: (A:) protein (aml-1b)

SCOPe Domain Sequences for d1b8xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b8xa1 a.45.1.1 (A:81-260) Class beta GST {Escherichia coli [TaxId: 562]}
lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt
ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw
plqgwqatfgggdhppksdlvprgsrrasvgsrmhypgaftysptpvtsgigigmsamgs

SCOPe Domain Coordinates for d1b8xa1:

Click to download the PDB-style file with coordinates for d1b8xa1.
(The format of our PDB-style files is described here.)

Timeline for d1b8xa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b8xa2