Class a: All alpha proteins [46456] (290 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
Protein Class beta GST [81357] (4 species) |
Species Escherichia coli [TaxId:562] [47638] (3 PDB entries) |
Domain d1b8xa1: 1b8x A:81-260 [17739] Other proteins in same PDB: d1b8xa2 fused with nuclear matrix targeting signal of transcription factor AML-1 |
PDB Entry: 1b8x (more details), 2.7 Å
SCOPe Domain Sequences for d1b8xa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8xa1 a.45.1.1 (A:81-260) Class beta GST {Escherichia coli [TaxId: 562]} lggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchkt ylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyiaw plqgwqatfgggdhppksdlvprgsrrasvgsrmhypgaftysptpvtsgigigmsamgs
Timeline for d1b8xa1: