SCOPe 2.01: Domain d3hcob_: 3hco B:

Lineage for d3hcob_ (3hco B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.1: Ferrochelatase [53801] (2 proteins)

6. Protein automated matches [190319] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187137] (2 PDB entries)

8. Domain d3hcob_: 3hco B: [177389]
   automated match to d1hrka_
   complexed with bct, chd, fes, gol, hem, imd, so4

Details for d3hcob_

PDB Entry: 3hco, 1.8 Å

PDB Description: human ferrochelatase with cd and protoporphyrin ix bound

PDB Compounds: (B:) Ferrochelatase, mitochondrial

SCOPe Domain Sequences for d3hcob_:

Sequence; same for both SEQRES and ATOM records:

>d3hcob_ c.92.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrrtpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

Timeline for d3hcob_:

• d3hcob_ is new in SCOPe 2.01-stable
  
• d3hcob_ appears in SCOPe 2.02
  
• d3hcob_ appears in the current release, SCOPe 2.08