Lineage for d3hcna_ (3hcn A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1008088Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 1008089Superfamily c.92.1: Chelatase [53800] (4 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 1008090Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
  6. 1008091Protein Ferrochelatase [53802] (3 species)
  7. 1008113Species Human (Homo sapiens) [TaxId:9606] [64189] (14 PDB entries)
  8. 1008114Domain d3hcna_: 3hcn A: [177386]
    automated match to d1hrka_
    complexed with bct, chd, fes, gol, hem, imd, so4

Details for d3hcna_

PDB Entry: 3hcn (more details), 1.6 Å

PDB Description: Hg and protoporphyrin bound Human Ferrochelatase
PDB Compounds: (A:) Ferrochelatase, mitochondrial

SCOPe Domain Sequences for d3hcna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hcna_ c.92.1.1 (A:) Ferrochelatase {Human (Homo sapiens) [TaxId: 9606]}
rkpktgilmlnmggpetlgdvhdfllrlfldrdlmtlpiqnklapfiakrrtpkiqeqyr
rigggspikiwtskqgegmvklldelspntaphkyyigfryvhplteeaieemerdgler
aiaftqypqyscsttgsslnaiyryynqvgrkptmkwstidrwpthhlliqcfadhilke
ldhfplekrsevvilfsahslpmsvvnrgdpypqevsatvqkvmerleycnpyrlvwqsk
vgpmpwlgpqtdesikglcergrknillvpiaftsdhietlyeldieysqvlakecgven
irraeslngnplfskaladlvhshiqsnelcskqltlscplcvnpvcretksfftsqql

SCOPe Domain Coordinates for d3hcna_:

Click to download the PDB-style file with coordinates for d3hcna_.
(The format of our PDB-style files is described here.)

Timeline for d3hcna_: