Class b: All beta proteins [48724] (180 folds) |
Fold b.88: Mss4-like [51315] (2 superfamilies) complex fold made of several coiled beta-sheets |
Superfamily b.88.1: Mss4-like [51316] (5 families) duplication: tandem repeat of two similar structural motifs |
Family b.88.1.3: SelR domain [75041] (3 proteins) automatically mapped to Pfam PF01641 |
Protein automated matches [191095] (2 species) not a true protein |
Species Neisseria meningitidis [TaxId:65699] [189075] (2 PDB entries) |
Domain d3hcgc_: 3hcg C: [177380] automated match to d1l1db_ complexed with po4 |
PDB Entry: 3hcg (more details), 1.82 Å
SCOPe Domain Sequences for d3hcgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hcgc_ b.88.1.3 (C:) automated matches {Neisseria meningitidis [TaxId: 65699]} ykkpsdaelkrtlteeqyqvtqnsateyafsheydhlfkpgiyvdvvsgeplfssadkyd sgcgwpsftrpidaksvtehddfsynmrrtevrshaadshlghvfpdgprdkgglrycin gaslkfipleqmdaagygalkskv
Timeline for d3hcgc_: