Lineage for d3hcgc_ (3hcg C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2818899Fold b.88: Mss4-like [51315] (2 superfamilies)
    complex fold made of several coiled beta-sheets
  4. 2818900Superfamily b.88.1: Mss4-like [51316] (5 families) (S)
    duplication: tandem repeat of two similar structural motifs
  5. 2818941Family b.88.1.3: SelR domain [75041] (3 proteins)
    automatically mapped to Pfam PF01641
  6. 2818955Protein automated matches [191095] (2 species)
    not a true protein
  7. 2818958Species Neisseria meningitidis [TaxId:65699] [189075] (2 PDB entries)
  8. 2818961Domain d3hcgc_: 3hcg C: [177380]
    automated match to d1l1db_
    complexed with po4

Details for d3hcgc_

PDB Entry: 3hcg (more details), 1.82 Å

PDB Description: Structure of the C-terminal domain (MsrB) of Neisseria meningitidis PilB (reduced form)
PDB Compounds: (C:) Peptide methionine sulfoxide reductase msrA/msrB

SCOPe Domain Sequences for d3hcgc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hcgc_ b.88.1.3 (C:) automated matches {Neisseria meningitidis [TaxId: 65699]}
ykkpsdaelkrtlteeqyqvtqnsateyafsheydhlfkpgiyvdvvsgeplfssadkyd
sgcgwpsftrpidaksvtehddfsynmrrtevrshaadshlghvfpdgprdkgglrycin
gaslkfipleqmdaagygalkskv

SCOPe Domain Coordinates for d3hcgc_:

Click to download the PDB-style file with coordinates for d3hcgc_.
(The format of our PDB-style files is described here.)

Timeline for d3hcgc_: