SCOP 1.55: Domain d1a0fb1: 1a0f B:81-201

Lineage for d1a0fb1 (1a0f B:81-201)

1. Root: SCOP 1.55

2. Class a: All alpha proteins [46456] (138 folds)

3. Fold a.45: Glutathione S-transferases, C-terminal domain [47615] (1 superfamily)

4. Superfamily a.45.1: Glutathione S-transferases, C-terminal domain [47616] (1 family)

5. Family a.45.1.1: Glutathione S-transferases, C-terminal domain [47617] (2 proteins)

6. Protein Glutathione S-transferase [47618] (22 species)

7. Species Escherichia coli [TaxId:562] [47638] (2 PDB entries)

8. Domain d1a0fb1: 1a0f B:81-201 [17738]
   Other proteins in same PDB: d1a0fa2, d1a0fb2

Details for d1a0fb1

PDB Entry: 1a0f, 2.1 Å

PDB Description: crystal structure of glutathione s-transferase from escherichia coli complexed with glutathionesulfonic acid

SCOP Domain Sequences for d1a0fb1:

Sequence; same for both SEQRES and ATOM records:

>d1a0fb1 a.45.1.1 (B:81-201) Glutathione S-transferase {Escherichia coli}
qllapvnsisryktiewlnyiatelhkgftplfrpdtpeeykptvraqlekklqyvneal
kdehwicgqrftiadaylftvlrwayavklnleglehiaafmqrmaerpevqdalsaegl
k

Timeline for d1a0fb1:

• d1a0fb1 appears in SCOP 1.57
  
• d1a0fb1 appears in the current release, SCOPe 2.08