Lineage for d3hceb1 (3hce B:14-280)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468838Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2468839Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2469291Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 protein domains)
    automatically mapped to Pfam PF01234
  6. 2469313Protein automated matches [190168] (1 species)
    not a true protein
  7. 2469314Species Human (Homo sapiens) [TaxId:9606] [186895] (33 PDB entries)
  8. 2469380Domain d3hceb1: 3hce B:14-280 [177375]
    Other proteins in same PDB: d3hceb2
    automated match to d1hnnb_
    complexed with otr, sah

Details for d3hceb1

PDB Entry: 3hce (more details), 2.85 Å

PDB Description: crystal structure of e185d hpnmt in complex with octopamine and adohcy
PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d3hceb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hceb1 c.66.1.15 (B:14-280) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcldavspdlas
fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
rtyimpahlqtgvddvkgvffawaqkv

SCOPe Domain Coordinates for d3hceb1:

Click to download the PDB-style file with coordinates for d3hceb1.
(The format of our PDB-style files is described here.)

Timeline for d3hceb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hceb2
View in 3D
Domains from other chains:
(mouse over for more information)
d3hcea_