SCOPe 2.08: Domain d3hcbb1: 3hcb B:14-280

Lineage for d3hcbb1 (3hcb B:14-280)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families)

5. Family c.66.1.15: Arylamine N-methyltransferase [69547] (3 proteins)
   automatically mapped to Pfam PF01234

6. Protein automated matches [190168] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186895] (34 PDB entries)

8. Domain d3hcbb1: 3hcb B:14-280 [177369]
   Other proteins in same PDB: d3hcbb2
   automated match to d1hnnb_
   complexed with lt2, sah

Details for d3hcbb1

PDB Entry: 3hcb, 2.4 Å

PDB Description: Crystal Structure of hPNMT in Complex With Noradrenochrome and AdoHcy

PDB Compounds: (B:) Phenylethanolamine N-methyltransferase

SCOPe Domain Sequences for d3hcbb1:

Sequence; same for both SEQRES and ATOM records:

>d3hcbb1 c.66.1.15 (B:14-280) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdsapgqaavasayqrfepraylrnnyapprgdlcnpngvgpwklrclaqtfatgevsgr
tlidigsgptvyqllsacshfeditmtdflevnrqelgrwlqeepgafnwsmysqhacli
egkgecwqdkerqlrarvkrvlpidvhqpqplgagspaplpadalvsafcleavspdlas
fqraldhittllrpgghllligaleeswylagearltvvpvseeevrealvrsgykvrdl
rtyimpahlqtgvddvkgvffawaqkv

Timeline for d3hcbb1:

• d3hcbb1 first appeared in SCOPe 2.01, called d3hcbb_
  
• d3hcbb1 appears in SCOPe 2.07